DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and cela1.2

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001307331.1 Gene:cela1.2 / 100535584 ZFINID:ZDB-GENE-050208-732 Length:269 Species:Danio rerio


Alignment Length:275 Identity:90/275 - (32%)
Similarity:143/275 - (52%) Gaps:27/275 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIILALAVAAS-AFPEPELRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALSS--A 65
            |.||.|:|.|: |..||      |.:..:. |..|:.||..|....:|:|:  ||:.|.|.:  .
Zfish     2 LRILLLSVLATLALAEP------RYLKDIA-IEERVVGGEIAKPHSWPWQI--SLQYSDLGTYYY 57

  Fly    66 WCGGSLIGSTWVLTAAHCTDGVQSVTVYLG-ATVRTSAEITHTVSSSDIIIHSGWNSANLR--ND 127
            :|.|:||...||:.||||.:.::..||.|| ..:.|.......:|.|::.||..||..|:.  .|
Zfish    58 YCSGTLIRPGWVMVAAHCVEALRKWTVALGDHDIYTHEGPEQYISVSEVFIHPNWNPNNVAFGYD 122

  Fly   128 ISLIKIPATSS-SSRISAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQYVDLTVITN 191
            |:|:::...:: ||.:....||| |.....: |.....:|||.| :|...::..|:...:.|:..
Zfish   123 IALLRLSIDATLSSYVQVATLPS-SGEILPY-GHTCYITGWGYT-ETGGSLSAQLKQAYMPVVDY 184

  Fly   192 TKCAQT--YGTSVVTDSTLCVATTDAKSTCNGDSGGPLVLKSSSEQI--GLTSFGASAGCEKGY- 251
            ..|:|.  :|:| |.::.:|...|.:.|.|:||||.||....:.:.:  |:|||.:..||.. | 
Zfish   185 ETCSQKDWWGSS-VKETMICAGGTTSMSACHGDSGSPLNCLFNGKYVVHGVTSFVSPEGCNT-YK 247

  Fly   252 -PAAFTRVTSYLDWI 265
             |..||||::|::||
Zfish   248 KPTGFTRVSAYINWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 77/239 (32%)
Tryp_SPc 38..268 CDD:238113 78/240 (33%)
cela1.2NP_001307331.1 Tryp_SPc 29..262 CDD:214473 77/239 (32%)
Tryp_SPc 30..265 CDD:238113 78/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.