DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and si:dkey-238d18.3

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001373176.1 Gene:si:dkey-238d18.3 / 795978 ZFINID:ZDB-GENE-131127-38 Length:272 Species:Danio rerio


Alignment Length:317 Identity:88/317 - (27%)
Similarity:131/317 - (41%) Gaps:74/317 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FLLLLSSTL---VKSSEPWLDTFEHPKEET---PDDDDAIMERRWQLGYENFRLRCEKFEMEGNQ 69
            ||..::|||   |:....|.     .||.|   |.|.|                           
Zfish     7 FLAFVASTLGCGVRQPLGWA-----AKESTTKKPIDGD--------------------------- 39

  Fly    70 TAAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTG 134
               :...|..|..|.|  :|:||.:... ||..|  ||||||...:|||||||...|.:..:..|
Zfish    40 ---IHEGIMQGVDALR--WPWQVSIKTS-SGEHL--CGGSLINKFWVLTAAHCQIQARSHYVVLG 96

  Fly   135 --------ATVFADVEDSVEELQ--VTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIE 189
                    .||      .|:|:.  :||.|..|...:     .:|:.|::|....:.:..|.|:.
Zfish    97 QHDRSSNDGTV------QVKEIAKVITHPDNNIQTLF-----NNDVTLLKLSSPAQMTSLVSPVC 150

  Fly   190 LAGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCT 254
            ||..  ....:.|.:...:|||  ...|:...|:||.....::.|.:|...|....::... :|.
Zfish   151 LASS--SSKIVPGTLCVTTGWG--RTKTELSARILQEATIPIVSQSQCKQIFGASKITNSM-ICA 210

  Fly   255 DGSNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWI 311
            .|| |..:|.||||||::.....|.|.:|:.|:|:.: |.|..|.||.|::.:..||
Zfish   211 GGS-GSSSCQGDSGGPLMCESSGVWYQVGIVSWGNRD-CRVDFPLVYARVSYFRKWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 73/244 (30%)
Tryp_SPc 77..314 CDD:238113 75/245 (31%)
si:dkey-238d18.3NP_001373176.1 Tryp_SPc 52..268 CDD:238113 72/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.