DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and gzma

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_001335166.1 Gene:gzma / 795070 ZFINID:ZDB-GENE-091204-156 Length:257 Species:Danio rerio


Alignment Length:225 Identity:70/225 - (31%)
Similarity:104/225 - (46%) Gaps:45/225 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 KCGGSLITLQFVLTAAHCLTDAIAAKIYTGATV-FADVEDSVEELQVTHRDFIIYPDYLGFGGYS 168
            ||||.||..::|||||||..|:     |:..|| ...:..|....::...::.|...:.......
Zfish    51 KCGGILIHKEWVLTAAHCKEDS-----YSSVTVLIGSLSLSKGSQRIAIHNYEIPETFNKKTKKD 110

  Fly   169 DLALIRLPRKVRT--------SEQVQPIELAGEFMHQNFLVGKVVTLSGWG---YLG-DSTDKRT 221
            |:.||||.:||:.        .:.|||              |....:.|||   |.| .::||  
Zfish   111 DIMLIRLSKKVKAKPYKIPKKEKDVQP--------------GTKCVVRGWGTTDYKGKQASDK-- 159

  Fly   222 RLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGS-NGRGACNGDSGGPVVYHWRNVSYLIGVT 285
              ||.|:..|:|:.:|..|:....|..:..||...: ..||.|.||||||:... :|   |:||.
Zfish   160 --LQMLEVLVVDRVQCNRYYNRNPVITKDMLCAGNTQQHRGTCLGDSGGPLECE-KN---LVGVL 218

  Fly   286 SFGSAEGC-EVGGPTVYTRIT-AYLPWIRQ 313
            |  .:.|| :...|||||.:: .::.||.:
Zfish   219 S--GSHGCGDPKKPTVYTLLSKRHITWINK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 68/221 (31%)
Tryp_SPc 77..314 CDD:238113 70/225 (31%)
gzmaXP_001335166.1 Tryp_SPc 28..247 CDD:238113 70/225 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587689
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.