DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and Prss41

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001128559.1 Gene:Prss41 / 681033 RGDID:1584711 Length:324 Species:Rattus norvegicus


Alignment Length:338 Identity:91/338 - (26%)
Similarity:136/338 - (40%) Gaps:91/338 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLLSSTLVKSSEPWLDTFEHPKEETPDDDDAIMERRWQLGYENFRLRCEKFEMEGNQTAAVRTR 76
            ||||....|...||                 ...|.....|.:|..::.  ..|...:...:|:|
  Rat     9 LLLLLVVCVMLGEP-----------------GSREENQAAGLKNTDIKL--LSMPCGRRNDIRSR 54

  Fly    77 IAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATVFADV 141
            |.||..:.||.:|:|..|.::    ...:|||||::.::|||||||....:..|.:|        
  Rat    55 IVGGIESVRGRWPWQASLRLR----KFHRCGGSLLSHRWVLTAAHCFRKFLDPKKWT-------- 107

  Fly   142 EDSVEELQVTHRDFIIYPDYL---GFGG----------------YSDLALIRLPRKVRTSEQVQP 187
               |:..|:|.:     |.:.   .|.|                |.||||:||...|..::.:||
  Rat   108 ---VQLGQLTSK-----PSFWNREAFSGRYRVKDIIINSEDKLKYHDLALLRLASSVTYNKFIQP 164

  Fly   188 I---ELAGEFMHQNFLVGKVVTLSGWGYLGDSTD--KRTRLLQYLDAEVIDQERCICYFLPGLVS 247
            :   ..|....||     ....::|||.|.:...  .....|:.:...|::..||...|   ..:
  Rat   165 VCVLPSASMSQHQ-----PRCWVTGWGALQEDLKPLPPPYHLREVQVTVLNLSRCQELF---SFA 221

  Fly   248 QRRHLCT---------DGSNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGG----PT 299
            .|.||.|         |||  ...|:||||||:|.:...:.|.||:.|.|  .||   |    |.
  Rat   222 SRYHLITRDVFCAGAEDGS--ADTCSGDSGGPLVCNMDGLWYQIGIVSRG--VGC---GRPKLPG 279

  Fly   300 VYTRITAYLPWIR 312
            :||.::.:..||:
  Rat   280 IYTNVSHHYDWIK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 77/271 (28%)
Tryp_SPc 77..314 CDD:238113 78/273 (29%)
Prss41NP_001128559.1 Tryp_SPc 54..291 CDD:214473 77/271 (28%)
Tryp_SPc 55..292 CDD:238113 77/271 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.