DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and ST14

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_068813.1 Gene:ST14 / 6768 HGNCID:11344 Length:855 Species:Homo sapiens


Alignment Length:302 Identity:87/302 - (28%)
Similarity:133/302 - (44%) Gaps:54/302 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KEETPDDDDAIMERRWQLGYENFRLRCEKFEMEGNQTAAVRTRIAGGELATRGMFPYQVGLVIQL 98
            ||:..|..|   |:....|..:|               ..:.|:.||..|..|.:|:||.|  ..
Human   590 KEDCSDGSD---EKDCDCGLRSF---------------TRQARVVGGTDADEGEWPWQVSL--HA 634

  Fly    99 SGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIY--TGATVFADVED-------SVEELQVTHRD 154
            .|...: ||.|||:..::::||||..|....:..  |..|.|..:.|       .|:|.::  :.
Human   635 LGQGHI-CGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRL--KR 696

  Fly   155 FIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFLVGKVVTLSGWG---YLGDS 216
            .|.:|.:..|....|:||:.|.:....|..|:||.|. :..|. |..||.:.::|||   |.|..
Human   697 IISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLP-DASHV-FPAGKAIWVTGWGHTQYGGTG 759

  Fly   217 TDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGSNGRGACNGDSGGPVVYHWRNVS-- 279
                ..:||..:..||:|..|. ..||..::.|.......|.|..:|.||||||:    .:|.  
Human   760 ----ALILQKGEIRVINQTTCE-NLLPQQITPRMMCVGFLSGGVDSCQGDSGGPL----SSVEAD 815

  Fly   280 ---YLIGVTSFGSAEGC-EVGGPTVYTRITAYLPWIRQQTAM 317
               :..||.|:|  :|| :...|.||||:..:..||::.|.:
Human   816 GRIFQAGVVSWG--DGCAQRNKPGVYTRLPLFRDWIKENTGV 855

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 77/252 (31%)
Tryp_SPc 77..314 CDD:238113 78/254 (31%)
ST14NP_068813.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SEA 88..>171 CDD:307516
CUB 227..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 488..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060 5/14 (36%)
Tryp_SPc 615..852 CDD:238113 78/254 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.