DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and TPSB2

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_077078.5 Gene:TPSB2 / 64499 HGNCID:14120 Length:275 Species:Homo sapiens


Alignment Length:271 Identity:83/271 - (30%)
Similarity:117/271 - (43%) Gaps:58/271 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 AAVRTRIAGGELATRGMFPYQVGLVIQLSGAD---LVKCGGSLITLQFVLTAAHCLTDAIAAKIY 132
            |..|..|.||:.|.|..:|:||.|.::    |   :..||||||..|:|||||||          
Human    25 ALQRVGIVGGQEAPRSKWPWQVSLRVR----DRYWMHFCGGSLIHPQWVLTAAHC---------- 75

  Fly   133 TGATVFADVED------SVEELQVTHRD-------FIIYPDYLGFGGYSDLALIRLPRKVRTSEQ 184
                |..||:|      .:.|..:.::|       .|::|.:......:|:||:.|...|..|..
Human    76 ----VGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSH 136

  Fly   185 VQPIEL--AGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRL-----LQYLDAEVIDQERCIC-YF 241
            |..:.|  |.|    .|..|....::|||    ..|...||     |:.:...:::...|.. |.
Human   137 VHTVTLPPASE----TFPPGMPCWVTGWG----DVDNDERLPPPFPLKQVKVPIMENHICDAKYH 193

  Fly   242 LPGLVSQRRHLCTD-----GSNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGC-EVGGPTV 300
            |.........:..|     |:..|.:|.||||||:|..........||.|:|  ||| :...|.:
Human   194 LGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWG--EGCAQPNRPGI 256

  Fly   301 YTRITAYLPWI 311
            |||:|.||.||
Human   257 YTRVTYYLDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 79/264 (30%)
Tryp_SPc 77..314 CDD:238113 81/265 (31%)
TPSB2NP_077078.5 Tryp_SPc 31..268 CDD:238113 81/265 (31%)
Tryp_SPc 31..267 CDD:214473 79/263 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152894
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.