DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and PRSS22

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_071402.1 Gene:PRSS22 / 64063 HGNCID:14368 Length:317 Species:Homo sapiens


Alignment Length:250 Identity:79/250 - (31%)
Similarity:120/250 - (48%) Gaps:23/250 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAI----AAKIYTGAT 136
            |:.|||.:|...:|:.|.  ||.:|..  .|.|||:|.::|:|||||..|.:    ...:..||.
Human    49 RVVGGEDSTDSEWPWIVS--IQKNGTH--HCAGSLLTSRWVITAAHCFKDNLNKPYLFSVLLGAW 109

  Fly   137 VFADVEDSVEELQVTHRDFIIYPDY-LGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFL 200
            ...:.....:::.|...:  .:|.| ...|..:|:||:||.|.::.||:|.||.|....:|  ..
Human   110 QLGNPGSRSQKVGVAWVE--PHPVYSWKEGACADIALVRLERSIQFSERVLPICLPDASIH--LP 170

  Fly   201 VGKVVTLSGWGYLGDSTD-KRTRLLQYLDAEVIDQERCICYFLPGL----VSQRRHLCTDGSNG- 259
            ......:||||.:.|... ...:.||.|...:||.|.|...:..|.    :::.. ||.....| 
Human   171 PNTHCWISGWGSIQDGVPLPHPQTLQKLKVPIIDSEVCSHLYWRGAGQGPITEDM-LCAGYLEGE 234

  Fly   260 RGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGC-EVGGPTVYTRITAYLPWIRQ 313
            |.||.||||||::........|.|:.|:|  ||| |...|.||..::|:..|:.:
Human   235 RDACLGDSGGPLMCQVDGAWLLAGIISWG--EGCAERNRPGVYISLSAHRSWVEK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 78/246 (32%)
Tryp_SPc 77..314 CDD:238113 78/248 (31%)
PRSS22NP_071402.1 Tryp_SPc 50..288 CDD:238113 78/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.