DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and cela2a

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_017945752.1 Gene:cela2a / 594883 XenbaseID:XB-GENE-970278 Length:269 Species:Xenopus tropicalis


Alignment Length:249 Identity:82/249 - (32%)
Similarity:119/249 - (47%) Gaps:21/249 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATV 137
            |.:|:..||......:|:||.|.....|.....||||||:..:|||||||::.....::..|...
 Frog    25 VVSRVVNGEDVAPHSWPWQVSLQYLYYGYWYHTCGGSLISSNWVLTAAHCISSYNTYRVQLGKHN 89

  Fly   138 FADVEDSVEELQVTHRDFIIYP--DYLGFGGYSDLALIRLPRKVRTSEQVQPIEL--AGEFM-HQ 197
            ...:|...:.:.|:  ..|.:|  |....|...|::||:|...|..|:.|||..|  ||..: ||
 Frog    90 LRYIEPGQKIINVS--KLINHPRWDPNSLGNGFDISLIKLEESVDFSDTVQPACLPPAGYILPHQ 152

  Fly   198 NFLVGKVVTLSGWGYL---GDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGSNG 259
               .|..||  |||.:   |...|    :||.....|:|...|..:...|...:...:|..|...
 Frog   153 ---YGCYVT--GWGNIRTGGPEPD----ILQQGLLLVVDYATCSQWDWWGDGVRTNMICAGGDGI 208

  Fly   260 RGACNGDSGGPVVYHWRNVSYLI-GVTSFGSAEGCEV-GGPTVYTRITAYLPWI 311
            ..:||||||||:.....|.::.: ||.|||||.||.. ..|:|::|::.:..||
 Frog   209 TSSCNGDSGGPLNCRNANGTWEVHGVVSFGSAAGCNYPKKPSVFSRVSEFNSWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 79/244 (32%)
Tryp_SPc 77..314 CDD:238113 80/245 (33%)
cela2aXP_017945752.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.