DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CG18735

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster


Alignment Length:356 Identity:94/356 - (26%)
Similarity:146/356 - (41%) Gaps:94/356 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FFLLLLSST-----------LVKSSEP-----------------WLDTFEHPKEETPDDDDAIME 46
            |.|||:.:|           |..:|:|                 |:.:...|  |.|.:..:..:
  Fly     4 FHLLLILATALGDLACATPSLRSASDPEKILNNLAQLRQSSFLDWIQSILGP--EVPAEWSSPAK 66

  Fly    47 RRWQLGYENFRLRCEKFEMEGNQTAAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLI 111
            |      |.....|      ||  ...|.||.||:......:|:    :|.|.......||.||:
  Fly    67 R------ECAECSC------GN--INTRHRIVGGQETEVHEYPW----MIMLMWFGNFYCGASLV 113

  Fly   112 TLQFVLTAAHCLTDAIAAKIYTGATVFADVEDSVEELQVTHR---DFIIYPDYLGFGGYSDLALI 173
            ..|:.||||||: :....::.|...:..:.:||  .:::..|   ..:|:|.|......||:|||
  Fly   114 NDQYALTAAHCV-NGFYHRLITVRLLEHNRQDS--HVKIVDRRVSRVLIHPKYSTRNFDSDIALI 175

  Fly   174 RLPRKVRTSEQVQPIELAGEFMHQNFLVGKVVTLSGWGYL---GDSTDKRTRLLQYLDAEVIDQE 235
            |....||....:.|:.:...  .:|: .|:...::|||.|   |..:|    .||.::..::.||
  Fly   176 RFNEPVRLGIDMHPVCMPTP--SENY-AGQTAVVTGWGALSEGGPISD----TLQEVEVPILSQE 233

  Fly   236 RC--------------ICYFLPGLVSQRRHLCTDGSNGRGACNGDSGGPVVYHWRNVSY-LIGVT 285
            .|              ||   .|.|.|         .|:.:|.||||||:.......:| |.|:.
  Fly   234 ECRNSNYGESKITDNMIC---AGYVEQ---------GGKDSCQGDSGGPMHVLGSGDAYQLAGIV 286

  Fly   286 SFGSAEGC-EVGGPTVYTRITAYLPWIRQQT 315
            |:|  ||| :...|.||||:.::..||.:.|
  Fly   287 SWG--EGCAKPNAPGVYTRVGSFNDWIAENT 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 73/256 (29%)
Tryp_SPc 77..314 CDD:238113 74/258 (29%)
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 73/256 (29%)
Tryp_SPc 83..314 CDD:238113 74/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457791
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.