DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and Hgfac

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_445772.1 Gene:Hgfac / 58947 RGDID:70909 Length:653 Species:Rattus norvegicus


Alignment Length:331 Identity:94/331 - (28%)
Similarity:136/331 - (41%) Gaps:68/331 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 HPKEETPDDDDAIMERRW-------QLGYENFRL-RCEKFEM-------------EGNQTAA--- 72
            |.....||.|    ||.|       .|.:|..|| .||....             |...||.   
  Rat   332 HAYCRNPDKD----ERPWCYVVKDSALSWEYCRLAACESLARVHSRIPEVLATLPESTSTARPTC 392

  Fly    73 ---------VRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLT---- 124
                     :|.||.||..:..|..|:...:.|   |...  |.|||:...:|::||||.:    
  Rat   393 GKRHKKRTFLRPRIIGGSSSLPGSHPWLAAIYI---GNGF--CAGSLVHTCWVVSAAHCFSSSPP 452

  Fly   125 -DAIAAKIYTGATVFADVEDSVEELQVTHRDFIIYPDYLGFG-GYSDLALIRLPRK-----VRTS 182
             |:|.  :..|...|....|..:...:  ..::.|..|..|. ...||.||||.:|     || |
  Rat   453 RDSIT--VVLGQHFFNRTTDVTQTFAI--EKYVPYTLYSVFNPNDHDLVLIRLKKKGERCAVR-S 512

  Fly   183 EQVQPIEL--AGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGL 245
            :.||||.|  ||    .:|..|....::|||::.::....:..|......::...:|....:.|.
  Rat   513 QFVQPICLPEAG----SSFPTGHKCQIAGWGHMDENVSGYSNSLLEALVPLVADHKCSSPEVYGA 573

  Fly   246 VSQRRHLCTDGSNGRG-ACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGC-EVGGPTVYTRITAYL 308
            ......||....:.:. ||.||||||:|.....|:||.|:.|:|  :|| .:..|.||||::.|:
  Rat   574 DISPNMLCAGYFDCKSDACQGDSGGPLVCEKNGVAYLYGIISWG--DGCGRLNKPGVYTRVSNYV 636

  Fly   309 PWIRQQ 314
            .||..:
  Rat   637 DWINDR 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 75/249 (30%)
Tryp_SPc 77..314 CDD:238113 76/251 (30%)
HgfacNP_445772.1 FN2 99..145 CDD:128373
EGF_CA 159..194 CDD:238011
FN1 197..237 CDD:238018
EGF 242..274 CDD:278437
Kringle 283..364 CDD:278480 11/35 (31%)
Tryp_SPc 405..639 CDD:214473 75/249 (30%)
Tryp_SPc 406..641 CDD:238113 76/250 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.