DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:265 Identity:83/265 - (31%)
Similarity:122/265 - (46%) Gaps:36/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GNQTAAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKI 131
            |.....:..||.||..||.|.:|:    ::.|.|.....||||||..|:|||||||:.|...:.|
Zfish    26 GRPNPTLNPRIVGGVNATHGAWPW----MVSLQGRYGHFCGGSLINNQWVLTAAHCIVDQTPSSI 86

  Fly   132 --YTG--ATVFADVEDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAG 192
              |.|  .:..||    |..:..|.|..|.:|.|......:|:||::|...|:.::.::||.||.
Zfish    87 IVYLGKWRSYVAD----VNSISRTIRHIIPHPSYSNITKDNDIALLQLTSTVQYTDYIKPICLAD 147

  Fly   193 EFMHQNFLVGKVVTLSGWGYLG----DSTDKRTR---------LLQYLDAEVIDQERC--ICYFL 242
            |  :.||..|....::|||.:|    .....||.         :||..:.:|.....|  ||:  
Zfish   148 E--NSNFPRGTNSWVAGWGDIGVLGTGGIRGRTTVSVPLPHPGILQEAELKVYSNADCNNICH-- 208

  Fly   243 PGLVSQRRHLCTDGSNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGC-EVGGPTVYTRITA 306
             |.::...........|:...:||||||::... :|....||.|.|  .|| :...|.|:.|::.
Zfish   209 -GRITPNMICAGTRPGGKATFSGDSGGPLMTKC-SVWVQAGVLSHG--YGCAQPNLPEVFIRVSE 269

  Fly   307 YLPWI 311
            |..||
Zfish   270 YKQWI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 80/254 (31%)
Tryp_SPc 77..314 CDD:238113 81/255 (32%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 79/253 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.