DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and MASP1

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_011511291.1 Gene:MASP1 / 5648 HGNCID:6901 Length:735 Species:Homo sapiens


Alignment Length:281 Identity:74/281 - (26%)
Similarity:123/281 - (43%) Gaps:51/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RIAGGELATRGMFPYQVGLVIQLSGA---DLVKCGGSLITLQFVLTAAHCL------TDAIAAK- 130
            ||.||..|..|:||:|..:|::.:..   |.....|:|::..::|||||.|      |..|... 
Human   456 RIIGGRNAEPGLFPWQALIVVEDTSRVPNDKWFGSGALLSASWILTAAHVLRSQRRDTTVIPVSK 520

  Fly   131 ----IYTGATVFADVEDSVEELQVTHRDFIIYPDYLGFGGYS-DLALIRLPRKVRTSEQVQPI-- 188
                :|.|   ..||.|....:..:....:::||: ....|: |:||::|...|.....|.|:  
Human   521 EHVTVYLG---LHDVRDKSGAVNSSAARVVLHPDF-NIQNYNHDIALVQLQEPVPLGPHVMPVCL 581

  Fly   189 ---ELAGEFMHQNFLVGKVVTLSGWG----------YLGDSTDKRTRLLQYLDAEVIDQERCICY 240
               |..|...|...||      :|||          .:...|...:.:|||:...|:....|...
Human   582 PRLEPEGPAPHMLGLV------AGWGISNPNVTVDEIISSGTRTLSDVLQYVKLPVVPHAECKTS 640

  Fly   241 F--LPGLVSQRRHLCTDG--SNGRGACNGDSGGP-VVYHWRNVSYLI-GVTSFGSAEGC---EVG 296
            :  ..|..|...::...|  ..|:..|.|||||. |::...:..::: |:.|:|..|.|   :|.
Human   641 YESRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVIFDDLSQRWVVQGLVSWGGPEECGSKQVY 705

  Fly   297 GPTVYTRITAYLPWIRQQTAM 317
            |  |||:::.|:.|:.:|..:
Human   706 G--VYTKVSNYVDWVWEQMGL 724

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 72/273 (26%)
Tryp_SPc 77..314 CDD:238113 72/275 (26%)
MASP1XP_011511291.1 CUB 35..144 CDD:238001
FXa_inhibition 160..188 CDD:291342
CUB 192..301 CDD:278839
Sushi 308..369 CDD:278512
CCP 374..439 CDD:153056
Tryp_SPc 456..718 CDD:214473 72/273 (26%)
Tryp_SPc 457..718 CDD:238113 71/272 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.