DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and cela1.1

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001020645.2 Gene:cela1.1 / 553249 ZFINID:ZDB-GENE-050522-187 Length:282 Species:Danio rerio


Alignment Length:257 Identity:76/257 - (29%)
Similarity:125/257 - (48%) Gaps:36/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 AVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGAT 136
            |:..|:.|||:|....:|:|:.|..|..|.....|||:||...:|:.||||:.   .::|::.| 
Zfish    25 AIEERVIGGEIAKPHSWPWQISLQYQSGGRYHHYCGGTLIRPGWVMVAAHCVD---TSRIWSVA- 85

  Fly   137 VFADVEDSVE---ELQVTHRDFIIYPDY---LGFGGYSDLALIRLPRKVRTSEQVQPIELA--GE 193
             ..|.:.:..   |..::.:...|:|::   :...| :|:||::|......|..||...|.  ||
Zfish    86 -LGDHDTTTHEGPEQYISVKGVFIHPNWNPNIVANG-NDIALLQLSINATLSSYVQVATLPSYGE 148

  Fly   194 FMHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAE-------VIDQERCICYFLPGLVSQRRH 251
            .:.    .|....::|||        ||:....|.|:       |:|.|.|......|...:.|.
Zfish   149 ILP----YGHTCYITGWG--------RTQTGGSLSAQLKQAYMPVVDHETCSQSDWWGSTVKDRM 201

  Fly   252 LCTDGSNGRGACNGDSGGPVVYHWRNVSYLI-GVTSFGSAEGCEV-GGPTVYTRITAYLPWI 311
            :|..|:....||:||||.|:...: |..|:: |||||.::.||.. ..|||:||::.::.|:
Zfish   202 ICAGGTTSMSACHGDSGSPLNCLF-NGEYVVHGVTSFVASSGCNTYKKPTVFTRVSYHVSWL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 74/251 (29%)
Tryp_SPc 77..314 CDD:238113 74/252 (29%)
cela1.1NP_001020645.2 Tryp_SPc 29..261 CDD:214473 74/250 (30%)
Tryp_SPc 30..265 CDD:238113 74/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.