DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and ctrb.3

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001017724.1 Gene:ctrb.3 / 550419 ZFINID:ZDB-GENE-050417-229 Length:265 Species:Danio rerio


Alignment Length:254 Identity:74/254 - (29%)
Similarity:114/254 - (44%) Gaps:42/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATVF-- 138
            ||..||.|....:|:||.|. ..:|...  ||||||...:|:|||||       .:.|...|.  
Zfish    33 RIVNGEEAVPHSWPWQVSLQ-DFTGFHF--CGGSLINEFWVVTAAHC-------SVRTSHRVILG 87

  Fly   139 ------ADVEDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQ 197
                  ::.::.::.::|:  ....:|.|......:|:||::|......:..|.|:.||.  ...
Zfish    88 EHNKGKSNTQEDIQTMKVS--KVFTHPQYNSNTIENDIALVKLTAPASLNAHVSPVCLAE--ASD 148

  Fly   198 NFLVGKVVTLSGWGYLGDSTDKRTRL--------LQYLDAEVIDQERCICYFLPGLVSQRRHLCT 254
            ||..|.....||||.        ||.        ||.:...::..|.|..::  |...:...:|.
Zfish   149 NFASGMTCVTSGWGV--------TRYNALFTPDELQQVALPLLSNEDCKNHW--GSNIRDTMICA 203

  Fly   255 DGSNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQ 313
             |:.|..:|.||||||:|....|:..|:|:.|:||:. |:...|.||.|:|....|:.|
Zfish   204 -GAAGASSCMGDSGGPLVCQKDNIWTLVGIVSWGSSR-CDPTMPGVYGRVTELRDWVDQ 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 72/250 (29%)
Tryp_SPc 77..314 CDD:238113 73/253 (29%)
ctrb.3NP_001017724.1 Tryp_SPc 33..258 CDD:214473 72/250 (29%)
Tryp_SPc 34..261 CDD:238113 73/253 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.