DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and Hgfac

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_006504094.1 Gene:Hgfac / 54426 MGIID:1859281 Length:658 Species:Mus musculus


Alignment Length:336 Identity:98/336 - (29%)
Similarity:138/336 - (41%) Gaps:73/336 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 HPKEETPDDDDAIMERRW-------QLGYENFRL-RCEKFEMEGNQTAAV--------------- 73
            |.....||.|    ||.|       .|.:|..|| .||......:||..:               
Mouse   332 HAYCRNPDKD----ERPWCYVVKDNALSWEYCRLTACESLARVHSQTPEILAALPESAPAVRPTC 392

  Fly    74 ----------RTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLT---- 124
                      |.||.||..:..|..|:...:.|..|     .|.|||:...:|::||||..    
Mouse   393 GKRHKKRTFLRPRIIGGSSSLPGSHPWLAAIYIGNS-----FCAGSLVHTCWVVSAAHCFANSPP 452

  Fly   125 -DAIAAKIYTGATVFADVEDSVEELQVTHRDFIIYPDYLGFG-GYSDLALIRLPRK-----VRTS 182
             |:|.  :..|...|....|..:...:  ..::.|..|..|. ...||.||||.:|     || |
Mouse   453 RDSIT--VVLGQHFFNRTTDVTQTFGI--EKYVPYTLYSVFNPNNHDLVLIRLKKKGERCAVR-S 512

  Fly   183 EQVQPIEL--AGEFMHQNFLVGKVVTLSGWGYLGD---STDKRTRLLQYLDAEV--IDQERCICY 240
            :.||||.|  ||    .:|..|....::|||::.:   |||..:.....|:|.|  :...:|...
Mouse   513 QFVQPICLPEAG----SSFPTGHKCQIAGWGHMDEMQSSTDVSSYSNSLLEALVPLVADHKCSSP 573

  Fly   241 FLPGLVSQRRHLCTDGSNGRG-ACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGC-EVGGPTVYTR 303
            .:.|.......||....:.:. ||.||||||:|.....|:||.|:.|:|  :|| .:..|.||||
Mouse   574 EVYGADISPNMLCAGYFDCKSDACQGDSGGPLVCEKNGVAYLYGIISWG--DGCGRLNKPGVYTR 636

  Fly   304 ITAYLPWIRQQ 314
            :..|:.||..:
Mouse   637 VANYVDWINDR 647

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 80/254 (31%)
Tryp_SPc 77..314 CDD:238113 81/256 (32%)
HgfacXP_006504094.1 FN2 99..145 CDD:128373
EGF_CA 159..194 CDD:238011
FN1 197..237 CDD:238018
EGF_CA 242..275 CDD:238011
Kringle 283..364 CDD:333799 11/35 (31%)
Tryp_SPc 406..646 CDD:238113 81/255 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.