DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and Tpsab1

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:260 Identity:78/260 - (30%)
Similarity:122/260 - (46%) Gaps:36/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 AAVRTRIAGGELATRGMFPYQVGLVIQLSGAD---LVKCGGSLITLQFVLTAAHCL------TDA 126
            |..|..|.||:.|:...:|:||.|.:.    |   :..||||||..|:|||||||:      .:.
  Rat    60 AMPREGIVGGQEASGNKWPWQVSLRVN----DTYWMHFCGGSLIHPQWVLTAAHCVGPNKADPNK 120

  Fly   127 IAAKIYTGATVFADVEDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIEL- 190
            :..::......:.|...:|.:: ::|.||.|..|      .:|:||::|...|..:..|..:.| 
  Rat   121 LRVQLRKQYLYYHDHLLTVSQI-ISHPDFYIAQD------GADIALLKLTNPVNITSNVHTVSLP 178

  Fly   191 -AGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRL-LQYLDAEVIDQERCICYFLPGL-VSQRRHL 252
             |.|    .|..|.:..::|||.:.:........ |:.:...:::...|...:..|| .....|:
  Rat   179 PASE----TFPSGTLCWVTGWGNINNDVSLPPPFPLEEVQVPIVENRLCDLKYHKGLNTGDNVHI 239

  Fly   253 CTD-----GSNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGC-EVGGPTVYTRITAYLPWI 311
            ..|     |:.|..:|.||||||:|....:.....||.|:|  ||| :...|.:|||:|.||.||
  Rat   240 VRDDMLCAGNEGHDSCQGDSGGPLVCKVEDTWLQAGVVSWG--EGCAQPNRPGIYTRVTYYLDWI 302

  Fly   312  311
              Rat   303  302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 74/253 (29%)
Tryp_SPc 77..314 CDD:238113 76/254 (30%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 74/252 (29%)
Tryp_SPc 66..302 CDD:238113 74/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346459
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.