DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and prss60.2

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:245 Identity:76/245 - (31%)
Similarity:114/245 - (46%) Gaps:12/245 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 AAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAK--IYT 133
            |.:.:||.||..|..|.:|:||.|.....|...  ||||||:.::||||||||.....:.  :|.
Zfish    28 APLNSRIVGGVNAPEGSWPWQVSLQSPRYGGHF--CGGSLISSEWVLTAAHCLPGVSESSLVVYL 90

  Fly   134 GATVFADVEDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQN 198
            |......|  :..|........|::..|......:|:||:||...|..::.::|:.||.:  :..
Zfish    91 GRRTQQGV--NTHETSRNVAKIIVHSSYNSNTNDNDIALLRLSSAVTFNDYIRPVCLAAQ--NSV 151

  Fly   199 FLVGKVVTLSGWGYLGDSTD-KRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGSNGRGA 262
            :..|....::|||.:....: ....:||.....|:..:||......|.|:...........|:..
Zfish   152 YSAGTSSWITGWGDVQAGVNLPAPGILQETMIPVVANDRCNAQLGSGTVTNNMICAGLAKGGKDT 216

  Fly   263 CNGDSGGPVVYHWRNVSYLIGVTSFGSAEGC-EVGGPTVYTRITAYLPWI 311
            |.||||||:|.....|....|:||:|  .|| :...|.||||::.|..||
Zfish   217 CQGDSGGPMVTRLCTVWIQAGITSWG--YGCADPNSPGVYTRVSQYQSWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 73/238 (31%)
Tryp_SPc 77..314 CDD:238113 74/239 (31%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 73/238 (31%)
Tryp_SPc 34..267 CDD:238113 74/239 (31%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587860
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.