DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and PLG

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_000292.1 Gene:PLG / 5340 HGNCID:9071 Length:810 Species:Homo sapiens


Alignment Length:266 Identity:81/266 - (30%)
Similarity:128/266 - (48%) Gaps:43/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 CEKFEMEGNQTAAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLT 124
            |.|.::|..:...   |:.||.:|....:|:||.|..:..   :..|||:||:.::||||||||.
Human   567 CGKPQVEPKKCPG---RVVGGCVAHPHSWPWQVSLRTRFG---MHFCGGTLISPEWVLTAAHCLE 625

  Fly   125 DA---IAAKIYTGATVFADVEDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQ 186
            .:   .:.|:..||....::|..|:|::|:.  ..:.|.      ..|:||::|......:::|.
Human   626 KSPRPSSYKVILGAHQEVNLEPHVQEIEVSR--LFLEPT------RKDIALLKLSSPAVITDKVI 682

  Fly   187 PIELAGEFMHQNFLVGKVVT--LSGWGYLGDSTDKRTR------LLQYLDAEVIDQERCICY-FL 242
            |..|..    .|::|.....  ::|||        .|:      ||:.....||:.:.|..| ||
Human   683 PACLPS----PNYVVADRTECFITGWG--------ETQGTFGAGLLKEAQLPVIENKVCNRYEFL 735

  Fly   243 PGLVSQRRHLCTDG-SNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGC-EVGGPTVYTRIT 305
            .|.| |...||... :.|..:|.||||||:|...::...|.||||:|.  || ....|.||.|::
Human   736 NGRV-QSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGL--GCARPNKPGVYVRVS 797

  Fly   306 AYLPWI 311
            .::.||
Human   798 RFVTWI 803

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 76/248 (31%)
Tryp_SPc 77..314 CDD:238113 77/249 (31%)
PLGNP_000292.1 PAN_AP_HGF <38..97 CDD:238532
KR 101..183 CDD:214527
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..145
KR 183..263 CDD:214527
KR 273..354 CDD:214527
KR 375..456 CDD:214527
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 396..416
KR 479..560 CDD:214527
Tryp_SPc 580..803 CDD:214473 76/248 (31%)
Tryp_SPc 581..804 CDD:238113 77/249 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.