DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and C1s1

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001091086.1 Gene:C1s1 / 50908 MGIID:1355312 Length:694 Species:Mus musculus


Alignment Length:304 Identity:86/304 - (28%)
Similarity:130/304 - (42%) Gaps:76/304 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 RW---QLGYENFRLRC--------EKFEMEGNQTAAVRTRIAGGELATRGMFPYQVGLVIQLSGA 101
            ||   |||.|  ..||        |.|:        |..||.||:.|....||:||..       
Mouse   414 RWVNDQLGIE--LPRCIPACGVPTEPFQ--------VHQRIFGGQPAKIENFPWQVFF------- 461

  Fly   102 DLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGA-TVFADVEDSVEELQVTHRDFIIYPDY---- 161
            :..:..|:||...:||||||.|.......:|.|. :|...:.::.:.| .:.|.| |:|.:    
Mouse   462 NHPRASGALINEYWVLTAAHVLEKISDPLMYVGTMSVRTTLLENAQRL-YSKRVF-IHPSWKKED 524

  Fly   162 -----LGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFLVGKVVTLSGWGYLGDSTDKRT 221
                 ..|.  :|:||::|...|:...:|.||.|.|.....|...|.:..:||||    ||:|:.
Mouse   525 DPNTRTNFD--NDIALVQLKDPVKMGPKVSPICLPGTSSEYNVSPGDMGLISGWG----STEKKV 583

  Fly   222 RLLQYLDAEV----------IDQERCICYFLPGLVSQRRHLCTD-----GSNGRGACNGDSGGPV 271
            .::....|:|          :.:|.       ..|....::.||     |..|..:|:|||||..
Mouse   584 FVINLRGAKVPVTSLETCKQVKEEN-------PTVRPEDYVFTDNMICAGEKGVDSCHGDSGGAF 641

  Fly   272 VYHWRNVS----YLIGVTSFGSAEGCEVGGPTVYTRITAYLPWI 311
            .:...||:    |:.|:.|:|  :.|...|  |||::..|:.||
Mouse   642 AFQVPNVTVPKFYVAGLVSWG--KRCGTYG--VYTKVKNYVDWI 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 73/263 (28%)
Tryp_SPc 77..314 CDD:238113 74/264 (28%)
C1s1NP_001091086.1 CUB 24..135 CDD:238001
FXa_inhibition 149..177 CDD:373209
CUB 181..293 CDD:366096
CCP 307..361 CDD:153056
CCP 365..428 CDD:153056 7/15 (47%)
Tryp_SPc 443..681 CDD:214473 73/263 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.