DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and ctrb2

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001011477.1 Gene:ctrb2 / 496968 XenbaseID:XB-GENE-1002990 Length:263 Species:Xenopus tropicalis


Alignment Length:247 Identity:71/247 - (28%)
Similarity:110/247 - (44%) Gaps:24/247 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATVFA- 139
            ||..||.|..|.:|:||.|. ..:|...  |||||:...:|:|||||       .:.|...|.. 
 Frog    33 RIVNGENAVSGSWPWQVSLQ-DRTGFHF--CGGSLVNNLWVVTAAHC-------GVTTSHRVILG 87

  Fly   140 --DVEDSVEELQVTHRDFII-YPDYLGFGGYSDLALIRLPRKVRTSEQVQP--IELAGEFMHQNF 199
              |...|.|.:|......:. :|:|......:|:.|::|......:.:|.|  |..:.|..:.  
 Frog    88 EYDRSSSAEPIQTMSISRVFKHPNYNTNTMINDITLLKLSSTASFNSRVAPVCIPTSSEVFNS-- 150

  Fly   200 LVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGSNGRGACN 264
             ..:.:| :||||:...:......||.:...::....|..|:  |.......:|. |::|..:|.
 Frog   151 -PERCIT-TGWGYVDAYSKLSPNKLQQVTLPLLSNTECQRYW--GNKIHSTMICA-GASGASSCM 210

  Fly   265 GDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQQTA 316
            ||||||:|........|.|:.|:||:. |....|.||.|::....|:.|..|
 Frog   211 GDSGGPLVCARNGAWVLAGIVSWGSST-CSPSSPGVYARVSTLRSWMDQIVA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 68/240 (28%)
Tryp_SPc 77..314 CDD:238113 68/242 (28%)
ctrb2NP_001011477.1 Tryp_SPc 34..259 CDD:238113 68/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.