DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and st14

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_012821897.2 Gene:st14 / 448647 XenbaseID:XB-GENE-1008784 Length:845 Species:Xenopus tropicalis


Alignment Length:277 Identity:83/277 - (29%)
Similarity:137/277 - (49%) Gaps:26/277 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GYENFRLRCEKFEMEGNQTAAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFV 116
            |.:....:|..    |.:....::||.||..|..|.||:||.|.::   .:...||.||::...:
 Frog   584 GSDEISAKCNC----GKRPFTKKSRIVGGVNADTGEFPWQVSLHVK---GNKHTCGASLVSPTML 641

  Fly   117 LTAAHCLTDAIAAKIYTGATVFADVEDSVEELQVTHRDFI-----IYPDYLGFGGY---SDLALI 173
            ::||||..|..:.: |:.|:::.......::.|:..:|.:     ....::||...   :|::::
 Frog   642 ISAAHCFQDDQSMR-YSDASLWTAYLGLHDQAQLNSKDVVERKIKRIMAHIGFNDNTYDNDISVL 705

  Fly   174 RLPRKVRTSEQVQPIELAGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCI 238
            .|.:.|..::.:|||.:. |..| :|.|||.:.::|||.|.:...... :||..:..:|:|..| 
 Frog   706 ELEKPVDYTDFIQPICIP-ESTH-DFPVGKPIWVTGWGALKEGGGAAV-ILQKAEIRIINQTEC- 766

  Fly   239 CYFLPGLVSQRRHLCTD-GSNGRGACNGDSGGPV-VYHWRNVSYLIGVTSFGSAEGC-EVGGPTV 300
            ...|.|.::.|. ||.. .|.|..||.||||||: .....|..||.|:.|:|  ||| ....|.|
 Frog   767 NKLLDGQLTPRM-LCAGFVSGGIDACQGDSGGPLSSVELNNKVYLAGIVSWG--EGCARRNKPGV 828

  Fly   301 YTRITAYLPWIRQQTAM 317
            |||:.....|||.:|.:
 Frog   829 YTRVAMMRDWIRDKTGL 845

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 76/245 (31%)
Tryp_SPc 77..314 CDD:238113 78/247 (32%)
st14XP_012821897.2 SEA 76..167 CDD:396113
CUB 216..320 CDD:238001
CUB 328..432 CDD:238001
LDLa 442..474 CDD:238060
LDLa 476..511 CDD:238060
LDLa 513..547 CDD:238060
LDLa 554..587 CDD:197566 1/2 (50%)
Tryp_SPc 604..839 CDD:214473 76/245 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.