DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and MST1

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001380510.1 Gene:MST1 / 4485 HGNCID:7380 Length:737 Species:Homo sapiens


Alignment Length:219 Identity:61/219 - (27%)
Similarity:96/219 - (43%) Gaps:30/219 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 CGGSLITLQFVLTAAHCLTDA----IAAKIYTGATVFADVEDSVEELQ-VTHRDFIIYPDYLGFG 165
            |||||:..|::|||..|.:..    ...:::.| |:|.:.:.....|| |.....:..|      
Human   533 CGGSLVKEQWILTARQCFSSCHMPLTGYEVWLG-TLFQNPQHGEPSLQRVPVAKMVCGP------ 590

  Fly   166 GYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFLV--GKVVTLSGWGY---LGDSTDKRTRLLQ 225
            ..|.|.|::|.|.|..:::|..|.|..|:    ::|  |....::|||.   .|:.|.....|| 
Human   591 SGSQLVLLKLERSVTLNQRVALICLPPEW----YVVPPGTKCEIAGWGETKGTGNDTVLNVALL- 650

  Fly   226 YLDAEVIDQERCICYFLPGLVSQRRHLCTDGSNGR-GACNGDSGGPVVYHWRNVSYLIGVTSFGS 289
                .||..:.|.... .|.| :...:||:|.... |||.||.|||:.....|...|.|:. ..:
Human   651 ----NVISNQECNIKH-RGRV-RESEMCTEGLLAPVGACEGDYGGPLACFTHNCWVLEGII-IPN 708

  Fly   290 AEGCEVGGPTVYTRITAYLPWIRQ 313
            ........|.|:||::.::.||.:
Human   709 RVCARSRWPAVFTRVSVFVDWIHK 732

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 59/215 (27%)
Tryp_SPc 77..314 CDD:238113 61/219 (28%)
MST1NP_001380510.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.