DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CTRB2

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001020371.3 Gene:CTRB2 / 440387 HGNCID:2522 Length:263 Species:Homo sapiens


Alignment Length:249 Identity:71/249 - (28%)
Similarity:115/249 - (46%) Gaps:32/249 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 TRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHC---LTDAIAAKIYTGAT 136
            :||..||.|..|.:|:||.|. ..:|...  ||||||:..:|:|||||   .:|.:.|    |..
Human    32 SRIVNGEDAVPGSWPWQVSLQ-DKTGFHF--CGGSLISEDWVVTAAHCGVRTSDVVVA----GEF 89

  Fly   137 VFADVEDSVEELQVTHRDFIIY--PDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNF 199
            .....|::::.|::..    ::  |.:......:|:.|::|....|.|:.|..:.|..  ...:|
Human    90 DQGSDEENIQVLKIAK----VFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPS--ADDDF 148

  Fly   200 LVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTD-----GSNG 259
            ..|.:...:|||....:.:|....||.....::....|       ..|..|.: ||     |::|
Human   149 PAGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAEC-------KKSWGRRI-TDVMICAGASG 205

  Fly   260 RGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQ 313
            ..:|.||||||:|........|:|:.|:|| ..|....|.||.|:...:||:::
Human   206 VSSCMGDSGGPLVCQKDGAWTLVGIVSWGS-RTCSTTTPAVYARVAKLIPWVQK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 70/244 (29%)
Tryp_SPc 77..314 CDD:238113 70/247 (28%)
CTRB2NP_001020371.3 Tryp_SPc 33..256 CDD:214473 70/244 (29%)
Tryp_SPc 34..259 CDD:238113 70/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.