DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CG11313

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:326 Identity:88/326 - (26%)
Similarity:136/326 - (41%) Gaps:87/326 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TPDDDDAIMERRWQLGYENFRLRCEKFEMEGNQTAAVRTRIAGGELA----TRG------MFPYQ 91
            |||.|           |...|.|.....:  :.|......|.||::|    |:|      .|.:.
  Fly    79 TPDTD-----------YNTTRARPNDEVI--HSTLLPDRSICGGDIAYNQITKGNETVLTEFAWM 130

  Fly    92 VGLVIQLSGADLVK--CGGSLITLQFVLTAAHCLTDAIAAK----------------------IY 132
            |.|..:......::  |.||||..::|:|||||::.|..|:                      ..
  Fly   131 VLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVDCL 195

  Fly   133 TGATVFADVEDSVEELQVTHRDFIIYPDYLGFGG----YSDLALIRLPRKVRTSEQVQPIELAGE 193
            .|..:...|:.:|||::: |..|          |    ::|:|||||.|:|..|..::|:.|...
  Fly   196 NGRCLPEPVQIAVEEIRI-HESF----------GTRLFWNDIALIRLAREVAYSPSIRPVCLPST 249

  Fly   194 FMHQNFLVGKVVTLSGWG--YLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQR------- 249
            ...||:..|:..|::|||  ...:|:..:.:|.             :.|..|||..::       
  Fly   250 VGLQNWQSGQAFTVAGWGRTLTSESSPVKMKLR-------------VTYVEPGLCRRKYASIVVL 301

  Fly   250 --RHLCTDGSNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIR 312
              .|||.:|.:...:|:||||||::.....|..|.|:.|||...|... .|.|||.:.:|..||.
  Fly   302 GDSHLCAEGRSRGDSCDGDSGGPLMAFHEGVWVLGGIVSFGLNCGSRF-WPAVYTNVLSYETWIT 365

  Fly   313 Q 313
            |
  Fly   366 Q 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 77/283 (27%)
Tryp_SPc 77..314 CDD:238113 80/286 (28%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 76/276 (28%)
Tryp_SPc 116..364 CDD:214473 73/272 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457366
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.