DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CG9733

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:332 Identity:95/332 - (28%)
Similarity:143/332 - (43%) Gaps:75/332 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TFEHPKEETPDDDDAIMERRWQLGYENFRLRC---EKFEMEGNQT---------AAVRTRIAGGE 81
            :|..|::|         .|.|..|.:....|.   :....:|:..         ..:|.||..|:
  Fly   111 SFVFPRQE---------RRPWSFGNQPATSRTPFRKSSTSDGSSLLPQPPSCGGVGIRNRIYDGQ 166

  Fly    82 LATRGMFPYQVGLVI-QLSGADL-VKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATVFADVEDS 144
            ......||:.|.|.. :.||..| ..|.||||..::|||||||||..|..::.|..:|.....|:
  Fly   167 DTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRIEREVGTLVSVRLGEHDT 231

  Fly   145 ---------------------VEELQVTHRDFIIYPDYLGFGGYS--------DLALIRLPRKVR 180
                                 .||::|..|             ||        |:.|||:.|.||
  Fly   232 RTAVDCPPGGGSCSPEVQRLGFEEIRVHER-------------YSEKASNQVHDIGLIRMERNVR 283

  Fly   181 TSEQVQPIELAGEFMHQNFLVGKVVTLSGWGYLGDSTDK--RTRLLQYLDAEVIDQERCICYFLP 243
            .|:.:|||.|......::...|:..|::|||    .|.|  |:.:.|.:....:|..:|...|..
  Fly   284 YSDNIQPICLPSSVGLESRQSGQQFTVAGWG----RTLKMARSAVKQKVTVNYVDPAKCRQRFSQ 344

  Fly   244 GLVS-QRRHLCTDGSNGRGACNGDSGGPVVYHWRNVSYLI-GVTSFGSAEGCEVGGPTVYTRITA 306
            ..|: :...||..|...:.:|:||||||:: .:|:.|::: |:.|||...|.: ..|.|||.:.|
  Fly   345 IKVNLEPTQLCAGGQFRKDSCDGDSGGPLM-RFRDESWVLEGIVSFGYKCGLK-DWPGVYTNVAA 407

  Fly   307 YLPWIRQ 313
            |..||||
  Fly   408 YDIWIRQ 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 82/269 (30%)
Tryp_SPc 77..314 CDD:238113 85/272 (31%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 82/269 (30%)
Tryp_SPc 162..415 CDD:238113 85/272 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457354
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.