DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CG9737

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:275 Identity:81/275 - (29%)
Similarity:119/275 - (43%) Gaps:50/275 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHC-----LTDAIAAK-I 131
            |..||.|||:|....||:   |.:.:..::...|.|:||..:.:||||||     :.|....| :
  Fly   146 VTNRIYGGEIAELDEFPW---LALLVYNSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGLKHV 207

  Fly   132 YTGATVFADVEDSVEE----------LQVTHRDFIIYPDYLGFGG--YSDLALIRLPRKVRTSEQ 184
            ..|........|.:||          |.:.:....::|:|..|..  |:|:|:|||...|..:..
  Fly   208 RLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHF 272

  Fly   185 VQPIELAGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRLL-QY-----------LDAEVIDQERC 237
            |.||.|..:........|::.::||||        ||.|. :|           |....:..|.|
  Fly   273 VMPICLPNKSEPLTLAEGQMFSVSGWG--------RTDLFNKYFINIHSPIKLKLRIPYVSNENC 329

  Fly   238 ICYFLPGLVSQ--RRHLCTDGSNGRGACNGDSGGPVVY----HWRNVSYLIGVTSFGSAEGCEVG 296
             ...|.|...:  .:.:|..|...:..|.||||||::|    |.|.|:|  ||.|:|..:....|
  Fly   330 -TKILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAY--GVVSYGFTQCGMAG 391

  Fly   297 GPTVYTRITAYLPWI 311
            .|.|||.:..|..||
  Fly   392 KPAVYTNVAEYTDWI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 78/270 (29%)
Tryp_SPc 77..314 CDD:238113 79/271 (29%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 78/270 (29%)
Tryp_SPc 150..409 CDD:238113 79/271 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457520
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.