DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and Sb

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster


Alignment Length:318 Identity:89/318 - (27%)
Similarity:147/318 - (46%) Gaps:35/318 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SSTLVKSSE-PWLDTFEHP-----KEETPDDDDAIMERRWQLGYENFRLRCEKFEMEGNQTAAVR 74
            ||.:|.||: |...|...|     ..||.:..|:.:.....||:.. .:...:.|......|...
  Fly   478 SSGIVTSSQRPTQPTHRTPVLATSGIETNEISDSSIPDAGALGHVK-TISAARSECGVPTLARPE 541

  Fly    75 TRIAGGELATRGMFPYQVGL--VIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAA--KIYTGA 135
            |||.||:.|..|.:|:||.:  ......:...:|||:||...::.||.||:.|.:.:  :|..|.
  Fly   542 TRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHCVDDLLISQIRIRVGE 606

  Fly   136 TVFADVEDSVEELQVTHRDFIIYPDYLGFGGYS-DLALIRLPRKVRTSEQVQPIELAGEFMHQNF 199
            ..|:.|::.:..::......:::|.| .|..|. ||||::|.:.:..:..|.||.|...   .:.
  Fly   607 YDFSHVQEQLPYIERGVAKKVVHPKY-SFLTYEYDLALVKLEQPLEFAPHVSPICLPET---DSL 667

  Fly   200 LVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICY--------FLPGLVSQRRHLCTD- 255
            |:|...|::|||.|.:. .....:||.:...::..:.|...        |:|.:     .||.. 
  Fly   668 LIGMNATVTGWGRLSEG-GTLPSVLQEVSVPIVSNDNCKSMFMRAGRQEFIPDI-----FLCAGY 726

  Fly   256 GSNGRGACNGDSGGPVVYHWRNVS-YLIGVTSFGSAEGC-EVGGPTVYTRITAYLPWI 311
            .:.|:.:|.||||||:....::.. :|.|:.|:|.  || |...|.|.|||:.:.|||
  Fly   727 ETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGI--GCAEANLPGVCTRISKFTPWI 782

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 71/250 (28%)
Tryp_SPc 77..314 CDD:238113 72/251 (29%)
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 71/250 (28%)
Tryp_SPc 544..785 CDD:238113 72/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.