DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and ea

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:329 Identity:83/329 - (25%)
Similarity:139/329 - (42%) Gaps:64/329 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DDDAIMERRWQLGYENFR-LRC--EKFEMEGNQTA---------------------AVRTRIAGG 80
            |.|.:...|.|.||.|.: |.|  :::....::|.                     .:..||.||
  Fly    67 DTDRLYLSRSQCGYTNGKVLICCPDRYRESSSETTPPPKPNVTSNSLLPLPGQCGNILSNRIYGG 131

  Fly    81 ELATRGMFPYQVGLVIQLSGADLVK---CGGSLITLQFVLTAAHCL------TDAIAAKIYTG-- 134
            .......||:..  :|:.:.:...|   ||||||:.::|:||:||:      ||...:.:..|  
  Fly   132 MKTKIDEFPWMA--LIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGKALPTDWRLSGVRLGEW 194

  Fly   135 -ATVFADVEDSVE--------ELQVTHRDFIIYPDYL--GFGGYSDLALIRLPRKVRTSEQVQPI 188
             .....|.|..|.        .|.|.....|.:|||:  .....:|:||:||.::|..::.|:||
  Fly   195 DTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIALLRLAQQVEYTDFVRPI 259

  Fly   189 ELAGEF-MHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHL 252
            .|..:. :......|..:.::|||.....:....:|...::...:|:.:.: |....::.:...:
  Fly   260 CLPLDVNLRSATFDGITMDVAGWGKTEQLSASNLKLKAAVEGFRMDECQNV-YSSQDILLEDTQM 323

  Fly   253 CTDGSNGRGACNGDSGGPVV---------YHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYL 308
            |..|..|..:|.||||||::         |:     :|.||.|||.......|.|.|||.:..|:
  Fly   324 CAGGKEGVDSCRGDSGGPLIGLDTNKVNTYY-----FLAGVVSFGPTPCGLAGWPGVYTLVGKYV 383

  Fly   309 PWIR 312
            .||:
  Fly   384 DWIQ 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 71/266 (27%)
Tryp_SPc 77..314 CDD:238113 72/268 (27%)
eaNP_524362.2 CLIP 37..89 CDD:288855 8/21 (38%)
Tryp_SPc 127..386 CDD:214473 71/266 (27%)
Tryp_SPc 128..389 CDD:238113 72/268 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457514
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.