DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and ela2

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001132936.1 Gene:ela2 / 403061 ZFINID:ZDB-GENE-041117-1 Length:266 Species:Danio rerio


Alignment Length:254 Identity:73/254 - (28%)
Similarity:125/254 - (49%) Gaps:19/254 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATV 137
            :.:|:.||.......:|:|..|..|...:....|||:||..|:|||||||::.. ..::..|...
Zfish    24 IDSRVVGGSDVRPNSWPWQASLQYQSGSSFYHTCGGTLIDKQWVLTAAHCISSR-TYRVLLGKHN 87

  Fly   138 FADVEDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIEL--AGEFMHQNFL 200
            .....:|..: .::....|::.::..:...:|:|||:|...|..::::.|..|  :|..:..|  
Zfish    88 LPLSSESGSQ-AISPARIIVHENWDSYNIRNDIALIKLSTPVTFTDKISPACLPDSGSILPHN-- 149

  Fly   201 VGKVVTLSGWGYL---GDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGSNGRGA 262
              ....::|||.|   |...|    :||.....::||..|......|.:.....:|..|.....:
Zfish   150 --SPCYVTGWGRLWTGGPIAD----ILQQALLPIVDQATCTKSDWWGNLVTDLMVCAGGDGVVSS 208

  Fly   263 CNGDSGGPVVYHWRNVSYLI-GVTSFGSAEGCEV-GGPTVYTRITAYLPWIRQQTAMTN 319
            ||||||||:....|:.::.: |:.||||:.||.. ..|:|:||::.|:|||.:  .||:
Zfish   209 CNGDSGGPLNCQRRDGTWDVHGIVSFGSSLGCNYPKKPSVFTRVSGYIPWINK--VMTS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 69/241 (29%)
Tryp_SPc 77..314 CDD:238113 70/243 (29%)
ela2NP_001132936.1 Tryp_SPc 27..259 CDD:214473 69/241 (29%)
Tryp_SPc 28..262 CDD:238113 70/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBU3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.