DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CG7542

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:255 Identity:94/255 - (36%)
Similarity:144/255 - (56%) Gaps:16/255 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GNQTAA-----VRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDA 126
            |:.||.     |...|..||.|..|.||||.||.:.. |.....|||:||:..:::|||||:..|
  Fly    12 GSCTAVPLLTDVEPYITNGEPAEVGQFPYQAGLNVSF-GNWSTWCGGTLISHYWIITAAHCMDGA 75

  Fly   127 IAAKIYTGATVFAD-VEDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQ---- 186
            .:..:|.||....| .|:..|.:.|.....|::.:|:.....:|::|||||..|..:::::    
  Fly    76 ESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGFTDRIRAASL 140

  Fly   187 PIELAGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRH 251
            |..|.|:|.....:   ....||||...|::|..:.:|:|::..::....|..|: .|.||::. 
  Fly   141 PRRLNGQFPTYESI---RAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYW-SGAVSEKM- 200

  Fly   252 LCTDGSNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWI 311
            :|...::|:..|:||||||:||...|.|||||.||||::.||:||.|.|:|||::||.||
  Fly   201 ICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFPAVFTRISSYLDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 88/239 (37%)
Tryp_SPc 77..314 CDD:238113 90/240 (38%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 90/240 (38%)
Tryp_SPc 27..260 CDD:214473 88/238 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
54.920

Return to query results.
Submit another query.