DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CG11529

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:230 Identity:74/230 - (32%)
Similarity:116/230 - (50%) Gaps:15/230 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 FPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATVFADVEDSVEELQVTH 152
            |||||.|:.:......:.|||:|:..:::|||.||........:|.|.....|.|.| ..|.:..
  Fly    41 FPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVYLGTKSVEDTEVS-GGLVLRS 104

  Fly   153 RDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFLVGKVVTLSGWGYLGDST 217
            ..||::..:......:|:||::||:.|..:.::||..|...:.|..| .|..|..||||.:.:.|
  Fly   105 NKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQF-AGMSVVASGWGAMVEMT 168

  Fly   218 DKRTRLLQYLDAEVIDQERCICYF---LPGLVSQRRHLCTDGSNGRGACNGDSGGPVVYHWRNVS 279
            :..:  :||.:.:||....|...:   ..|::      |..|......|.||||||:|.  ::..
  Fly   169 NSDS--MQYTELKVISNAECAQEYDVVTSGVI------CAKGLKDETVCTGDSGGPLVL--KDTQ 223

  Fly   280 YLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQQ 314
            .::|:||||.|:|||...|..:||:|.||.||..:
  Fly   224 IVVGITSFGPADGCETNIPGGFTRVTHYLDWIESK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 72/225 (32%)
Tryp_SPc 77..314 CDD:238113 74/228 (32%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 74/228 (32%)
Tryp_SPc 37..255 CDD:214473 72/225 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
76.830

Return to query results.
Submit another query.