DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CG18179

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:253 Identity:86/253 - (33%)
Similarity:129/253 - (50%) Gaps:34/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RIAGGELATRGMFPYQVGLVIQLSGADLVKCG-GSLITLQFVLTAAHCL-TDAIAAKIYTGAT-- 136
            ||..|..|..|..||.|||:|:..|::....| |::|...::||||||| ||.:  :|:.|:.  
  Fly    39 RIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLTTDYV--EIHYGSNWG 101

  Fly   137 ---VFADVEDSVEELQVTHRD-FIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQ 197
               .|.         |...|| ||.:|::...|| .|:.|||.| .|..::.:..:.|.......
  Fly   102 WNGAFR---------QSVRRDNFISHPNWPAEGG-RDIGLIRTP-SVGFTDLINKVALPSFSEES 155

  Fly   198 NFLVGKVVTLSGWGYL--GDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGSNGR 260
            :..|.......|||.:  |:..|    .||.:|.::|....|...:  |.|:. ..:||..::|:
  Fly   156 DRFVDTWCVACGWGGMDNGNLAD----WLQCMDVQIISNSECEQSY--GTVAS-TDMCTRRTDGK 213

  Fly   261 GACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQQTAMT 318
            .:|.||||||:|.|  :.:.|:||.:|||.: |. .||:.|||:|.||.|||..|.::
  Fly   214 SSCGGDSGGPLVTH--DNARLVGVITFGSVD-CH-SGPSGYTRVTDYLGWIRDNTGIS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 82/244 (34%)
Tryp_SPc 77..314 CDD:238113 84/246 (34%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 82/244 (34%)
Tryp_SPc 40..263 CDD:238113 84/246 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.