DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CG8329

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:267 Identity:84/267 - (31%)
Similarity:126/267 - (47%) Gaps:49/267 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 NQTA----AVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCL-TDAI 127
            |:||    ..:..|..|..|..|..||.|||.:. :||   ..|||:|...:|||||||| ||::
  Fly    22 NRTAHHGGGPKDIIVNGYPAYEGKAPYAVGLRMN-NGA---VGGGSVIGNNWVLTAAHCLTTDSV 82

  Fly   128 -----AAKIYTGATVFADVEDSVEELQ--VTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQV 185
                 :.:.:.|            :||  |...:|..:|.|....|: |:.|||.| .|..:..:
  Fly    83 TIHYGSNRAWNG------------QLQHTVNKNNFFRHPGYPNSAGH-DIGLIRTP-YVSFTNLI 133

  Fly   186 QPIEL-----AGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGL 245
            ..:.|     .||.....:.|.     .|||  |.:.......||.:|.:||....|...:  |.
  Fly   134 NKVSLPKFSQKGERFENWWCVA-----CGWG--GMANGGLADWLQCMDVQVISNGECARSY--GS 189

  Fly   246 VSQRRHLCTDGSNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPW 310
            |:. ..:||..::|:..|.|||||.:|.|...:.  :||.:|.|. ||: .||:.|||::.:|.|
  Fly   190 VAS-TDMCTRATDGKSVCGGDSGGALVTHDNPIQ--VGVITFASI-GCK-SGPSGYTRVSDHLDW 249

  Fly   311 IRQQTAM 317
            ||:::.:
  Fly   250 IREKSGI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 78/247 (32%)
Tryp_SPc 77..314 CDD:238113 81/249 (33%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 81/249 (33%)
Tryp_SPc 35..250 CDD:214473 78/246 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.