DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and Jon66Cii

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster


Alignment Length:272 Identity:93/272 - (34%)
Similarity:125/272 - (45%) Gaps:45/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 RLRCEKF------EMEGNQTAAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQF 115
            ||..||.      :|:|        ||..|..|..|..||.|||  ..||.  ..||||:|...:
  Fly    22 RLATEKLTPVHTKDMQG--------RITNGYPAEEGKAPYTVGL--GFSGG--WWCGGSIIAHDW 74

  Fly   116 VLTAAHCLTDAIAAKIYTGATVFADVEDSVEELQVTHRDFIIYPDYLGFGGY-----SDLALIRL 175
            ||||.||:.||.:..:|.|||...:.       |.||        ::|.|.:     :|:||||:
  Fly    75 VLTAEHCIGDADSVTVYFGATWRTNA-------QFTH--------WVGNGNFIKHSSADIALIRI 124

  Fly   176 PRKVRTSEQVQPIELAGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICY 240
            |. |.....|..:||.......|..........|||...|.: .....||.:|.::|....|..|
  Fly   125 PH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGS-PLPDYLQCVDLQIIHNSECSGY 187

  Fly   241 FLPGLVSQRRHLCTDGSNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRIT 305
            :  |.|.. ..||....:|:..|.||||||:|.|  :.:.|:|||:|||..||:.|.|..:.|:|
  Fly   188 Y--GSVGD-NILCVRTPDGKSTCGGDSGGPLVTH--DGTKLVGVTNFGSVAGCQSGAPAGFQRVT 247

  Fly   306 AYLPWIRQQTAM 317
            .:|.|||..|.:
  Fly   248 YHLDWIRDHTGI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 83/239 (35%)
Tryp_SPc 77..314 CDD:238113 85/241 (35%)
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 83/239 (35%)
Tryp_SPc 40..256 CDD:238113 85/241 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
76.830

Return to query results.
Submit another query.