DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and TMPRSS11F

DIOPT Version :10

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_997290.2 Gene:TMPRSS11F / 389208 HGNCID:29994 Length:438 Species:Homo sapiens


Alignment Length:259 Identity:82/259 - (31%)
Similarity:122/259 - (47%) Gaps:45/259 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 IAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCL------TDAIAAKIYTGA 135
            :.|.|.|..|.:|:|..|.:..||.   :||.|||:..::||||||.      |..||.   .||
Human   207 VQGRETAMEGEWPWQASLQLIGSGH---QCGASLISNTWLLTAAHCFWKNKDPTQWIAT---FGA 265

  Fly   136 TVFAD-VEDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNF 199
            |:... |:.:|       |..|::.:|......:|:||::|...|..|..||.:.|....:.   
Human   266 TITPPAVKRNV-------RKIILHENYHRETNENDIALVQLSTGVEFSNIVQRVCLPDSSIK--- 320

  Fly   200 LVGKV-VTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCIC--------YFLPGLVSQRRHLCTD 255
            |..|. |.::|:|.:.|....:..|.| ...|.|..:  :|        ...||:      ||..
Human   321 LPPKTSVFVTGFGSIVDDGPIQNTLRQ-ARVETISTD--VCNRKDVYDGLITPGM------LCAG 376

  Fly   256 GSNGR-GACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEV-GGPTVYTRITAYLPWIRQQTAM 317
            ...|: .||.||||||:||...::.|::|:.|:|  :.|.: ..|.||||:|.|..||..:|.|
Human   377 FMEGKIDACKGDSGGPLVYDNHDIWYIVGIVSWG--QSCALPKKPGVYTRVTKYRDWIASKTGM 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 77..314 CDD:238113 80/254 (31%)
TMPRSS11FNP_997290.2 SEA 59..158 CDD:460188
Tryp_SPc 206..435 CDD:238113 80/254 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.