DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and Jon65Ai

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:248 Identity:81/248 - (32%)
Similarity:115/248 - (46%) Gaps:18/248 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 AAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGA 135
            |::..||..|..|..|..||.|||....:|.. ..||||:|...:|:||.||.....:..||.||
  Fly    32 ASIEGRITMGYPAYEGKVPYIVGLGFSKNGGG-TWCGGSIIGNTWVMTAKHCTDGMESVTIYYGA 95

  Fly   136 TVFADVEDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFL 200
                     :..||..:..::...|::..|. .|::|||.|. |.....|..:||.......|..
  Fly    96 ---------LWRLQAQYTHWVGRSDFIEHGS-GDISLIRTPH-VDFWSLVNKVELPRYDDRYNNY 149

  Fly   201 VGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGSNGRGACNG 265
            .|....:||||...|.... :..|..:|.::.:...|..|:  |..|... :|......:|.|:|
  Fly   150 QGWWALVSGWGKTSDEGGV-SEYLNCVDVQIGENSVCENYY--GSFSGDL-ICIPTPENKGTCSG 210

  Fly   266 DSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQQTAMT 318
            |||||:|.|..|..  :|:.||||:.||...||....|:|:||.|||..|.::
  Fly   211 DSGGPLVIHDGNRQ--VGIVSFGSSAGCLSNGPKGMVRVTSYLDWIRDNTGIS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 76/234 (32%)
Tryp_SPc 77..314 CDD:238113 78/236 (33%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 76/234 (32%)
Tryp_SPc 41..257 CDD:238113 77/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
76.830

Return to query results.
Submit another query.