DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and Jon65Aii

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:253 Identity:90/253 - (35%)
Similarity:119/253 - (47%) Gaps:25/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GNQTAAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKI 131
            ||:   :..||..|..|..|..||.|.|...........||||:|..::|||||||...|....|
  Fly    30 GNK---INGRITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAHCTYGASYVTI 91

  Fly   132 YTGATVFADVEDSVEELQVTHRDFIIYPDYLGFGG-YSDLALIRLPRKVRTSEQVQPIELAGEFM 195
            ..|| |:.      ::.|.||.|         .|. ::|:||||.|. |.....|..:||.....
  Fly    92 SYGA-VWR------QQPQFTHYD---------TGNLHNDIALIRTPH-VDFWSLVNKVELPRYDD 139

  Fly   196 HQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGSNGR 260
            ..|...|....|||||...||:. .|..|..:|.::.|...|:.|:....::. .|||......:
  Fly   140 RYNNFYGWWALLSGWGSSSDSSG-MTDYLNCVDIQISDNSVCLDYYGSHYITS-NHLCYATPENK 202

  Fly   261 GACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQQTAMT 318
            |:|:||||||:|.|..|..  :|:.|||||.||....|...||:|.||.|||..|.::
  Fly   203 GSCSGDSGGPLVLHDGNRQ--VGIVSFGSAAGCLSNSPKGLTRVTGYLDWIRDHTGIS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 84/235 (36%)
Tryp_SPc 77..314 CDD:238113 86/237 (36%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 84/235 (36%)
Tryp_SPc 37..254 CDD:238113 86/237 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.