DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CG10477

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:308 Identity:96/308 - (31%)
Similarity:140/308 - (45%) Gaps:41/308 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FFLLLLSSTLVKSSEPWLDTFEHPKEETPDDDDAIMERRWQLGYENFRLRCEKFEMEGNQTAAVR 74
            |.:|:|:...|.:.....||..||:     |..|:                          .::.
  Fly     4 FAVLVLAIATVSADILRQDTPVHPR-----DSSAV--------------------------PSID 37

  Fly    75 TRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATVFA 139
            .||..|..|....|||||||..: |.|....||||:|...:|||||||...|.:..||.|:||..
  Fly    38 GRITNGNKAAANQFPYQVGLSFK-SSAGSWWCGGSIIANTWVLTAAHCTKGASSVTIYYGSTVRT 101

  Fly   140 DVEDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFLVGKV 204
            ..:   .:.:|:...|:.:..|......:|::||:.| .|..:..:..|.|.......:...|:.
  Fly   102 SAK---LKKKVSSSKFVQHAGYNAATLRNDISLIKTP-SVTFTVSINKIALPAIASSYSTYAGQT 162

  Fly   205 VTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGSNGRGACNGDSGG 269
            ...||||...||:......|||...:||....|...|...:|:. ..:|.:..|.:..|.|||||
  Fly   163 AVASGWGRTSDSSIAVATNLQYAQFQVITNAVCQKTFGSSVVTS-GVICVESINKKSTCQGDSGG 226

  Fly   270 PVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQQTAM 317
            |:..:.|    |||||||.|::|||...|..:||:|:||.||:.|:.:
  Fly   227 PLALNNR----LIGVTSFVSSKGCEKNAPAGFTRVTSYLDWIKNQSGV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 83/234 (35%)
Tryp_SPc 77..314 CDD:238113 84/236 (36%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 83/234 (35%)
Tryp_SPc 40..267 CDD:238113 84/236 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
65.820

Return to query results.
Submit another query.