DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CG32269

DIOPT Version :10

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_647788.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster


Alignment Length:244 Identity:51/244 - (20%)
Similarity:76/244 - (31%) Gaps:78/244 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 GKFLLSAKRSRRATYTEYVISMDADNISRSSSTYIGKLKSNFLGTKFIVYDTAPAY--------- 143
            ||.:.:|...:|.........|.|:........|:|.|:          |:|...|         
  Fly  1214 GKIVTAAHSGKRFYVDSICYDMSAETSFPRKEGYLGPLE----------YNTYADYYKQKYGVDL 1268

  Fly   144 NSSQILSPPNRSRSFNSKKVSPKV-PSG-SYNIAQVTY------EL----NLLGT--RGPRRMNC 194
            |..|......|..|:....:||:. .|| |..:...||      ||    .|.|:  ||.:|:..
  Fly  1269 NCKQQPLIKGRGVSYCKNLLSPRFEQSGESETVLDKTYYVFLPPELCVVHPLSGSLIRGAQRLPS 1333

  Fly   195 IMHSIPSLALE---------PGGTVPSQPEFLQRSLDESF-----RSIGSSKI------------ 233
            ||..:.|:.|.         |..|..........|..|:|     ..:|.:.:            
  Fly  1334 IMRRVESMLLAVQLKNLISYPIPTSKILEALTAASCQETFCYERAELLGDAYLKWVVSRFLFLKY 1398

  Fly   234 -VNHSGDFTRPKEEEGKVRPLVL----------------KTKPPRWLQP 265
             ..|.|..||.:::  .|..:||                :..|.||..|
  Fly  1399 PQKHEGQLTRMRQQ--MVSNMVLYQFALVKGLQSYIQADRFAPSRWSAP 1445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 77..314 CDD:238113 51/244 (21%)
CG32269NP_647788.1 Tryp_SPc 108..324 CDD:214473
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.