DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and tpr

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:268 Identity:72/268 - (26%)
Similarity:118/268 - (44%) Gaps:53/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 AAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCL----TDAIAAKI 131
            |.::.||.||:......:|:    |..|.......|..||:..||:|||:||:    .:.|:.::
  Fly   121 ANIQKRIVGGQETEVHQYPW----VAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISVRL 181

  Fly   132 YTGATVFADVEDSVEELQVTHR---DFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIEL--- 190
                   .:.:..:..:|...|   :.|.:|.|......:|:|:|:|...|..:|.:.|:.:   
  Fly   182 -------LEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTP 239

  Fly   191 AGEFMHQNFLVGKVVTLSGWGYL---GDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHL 252
            ...|..:|.:|      :|||.|   |.::|    .||.:...::.|:.|       ..|:..:.
  Fly   240 GRSFKGENGIV------TGWGALKVGGPTSD----TLQEVQVPILSQDEC-------RKSRYGNK 287

  Fly   253 CTDG-------SNGRGACNGDSGGP--VVYHWRNVSYLIGVTSFGSAEGC-EVGGPTVYTRITAY 307
            .||.       ..|:.:|.||||||  :|........:.||.|:|  ||| :.|.|.||.|:..|
  Fly   288 ITDNMLCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWG--EGCAKAGYPGVYARVNRY 350

  Fly   308 LPWIRQQT 315
            ..||:..|
  Fly   351 GTWIKNLT 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 68/257 (26%)
Tryp_SPc 77..314 CDD:238113 69/259 (27%)
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 68/257 (26%)
Tryp_SPc 127..356 CDD:238113 69/258 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457787
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.