DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and PRSS41

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:263 Identity:77/263 - (29%)
Similarity:119/263 - (45%) Gaps:41/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATV 137
            :...:|||..:.||.:|:|..|.::...    :|||||::.::||:||||.     .|.|..:  
Human    67 IHALVAGGVESARGRWPWQASLRLRRRH----RCGGSLLSRRWVLSAAHCF-----QKHYYPS-- 120

  Fly   138 FADVEDSVEELQVTHR----------------DFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQ 186
                |.:|:..::|.|                |.|:.||.||. ..:|:||:||...|..:..:|
Human   121 ----EWTVQLGELTSRPTPWNLRAYSSRYKVQDIIVNPDALGV-LRNDIALLRLASSVTYNAYIQ 180

  Fly   187 PIELAGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRH 251
            ||.:  |....||:......::|||.:..|...........:|:|.......|.:|....|.|..
Human   181 PICI--ESSTFNFVHRPDCWVTGWGLISPSGTPLPPPYNLREAQVTILNNTRCNYLFEQPSSRSM 243

  Fly   252 L-----CTDGSNGR-GACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPW 310
            :     |....:|. ..|.||||||:|.....:.|.:|:.|:|...| :...|.|||.|:.|..|
Human   244 IWDSMFCAGAEDGSVDTCKGDSGGPLVCDKDGLWYQVGIVSWGMDCG-QPNRPGVYTNISVYFHW 307

  Fly   311 IRQ 313
            ||:
Human   308 IRR 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 74/256 (29%)
Tryp_SPc 77..314 CDD:238113 77/259 (30%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.