DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and TMPRSS9

DIOPT Version :10

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001382442.1 Gene:TMPRSS9 / 360200 HGNCID:30079 Length:1093 Species:Homo sapiens


Alignment Length:210 Identity:43/210 - (20%)
Similarity:76/210 - (36%) Gaps:43/210 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TWRLMCKD-----IVKSP----EFSGK-LTFPVSLKQPGPRDGIIQCYIKRDKSNMTYHLYLSLS 80
            |||....|     :...|    |.:|| |::.||.........:::.:..:.::.          
Human   536 TWREWSSDGKNLIVYWKPLPINEANGKILSYNVSCSLNEETQSVLEIFDPQHRAE---------- 590

  Fly    81 PAILVESGKFLLS--AKRSRRATYTEYVISMDADNISRSSSTYIGKLKSNFLGTK-FIVYDTAPA 142
              |.:....:::|  |:.|..::....:.||:..|...:....:|      ||.: |:.:...|.
Human   591 --IQLSKNDYIISVVARNSAGSSPPSKIASMEIPNDDITVEQAVG------LGNRIFLTWRHDPN 647

  Fly   143 YNSSQILSPPNRSRSFNSKKVSPKVPSGSYNIA--------QVTYELNLLG--TRGPRRMNCIMH 197
            .....::...|.|||........||||.|....        .|.|...|.|  .:|.:.:..|:.
Human   648 MTCDYVIKWCNSSRSEPCLLDWRKVPSNSTETVIESDQFQPGVRYNFYLYGCTNQGYQLLRSIIG 712

  Fly   198 SIPSLA--LEPGGTV 210
            .:..||  :.|..||
Human   713 YVEELAPIVAPNFTV 727

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 77..314 CDD:238113 32/149 (21%)
TMPRSS9NP_001382442.1 SEA 66..>127 CDD:460188
LDLa 188..223 CDD:238060
Tryp_SPc 236..465 CDD:214473
Tryp_SPc 538..768 CDD:238113 41/208 (20%)
Pneumo_att_G <717..>867 CDD:114270 5/11 (45%)
Tryp_SPc 861..1087 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.