DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CG8172

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster


Alignment Length:293 Identity:96/293 - (32%)
Similarity:131/293 - (44%) Gaps:51/293 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GYENFRLR----CEKFEMEGNQTAAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLIT 112
            ||.:...|    |.:.....|       ||.||.....|..|:||.|:........:.|||:||:
  Fly   294 GYHDASYRPVPGCGEVYTRSN-------RIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALIS 351

  Fly   113 LQFVLTAAHCL--TDAIAAKIYTGATVFADVEDSVEELQVTHRDF-----IIYPDYLGFGGYSDL 170
            .::|:|||||:  |.....||..|..   ||....|.|  .|.::     .::|.|......:|:
  Fly   352 NRWVITAAHCVASTPNSNMKIRLGEW---DVRGQEERL--NHEEYGIERKEVHPHYNPADFVNDV 411

  Fly   171 ALIRLPRKVRTSEQVQPIELAGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTR--------LLQYL 227
            |||||.|.|...:.:.|:.|...   ...|.||:.|::|||        |||        :||.:
  Fly   412 ALIRLDRNVVYKQHIIPVCLPPS---TTKLTGKMATVAGWG--------RTRHGQSTVPSVLQEV 465

  Fly   228 DAEVIDQERCICYFLPGLVSQRRH---LCT---DGSNGRGACNGDSGGPVVYHWRNVSYLIGVTS 286
            |.|||..:||..:|......:..|   ||.   ||  ||.:|.||||||:.........|||:.|
  Fly   466 DVEVISNDRCQRWFRAAGRREAIHDVFLCAGYKDG--GRDSCQGDSGGPLTLTMDGRKTLIGLVS 528

  Fly   287 FGSAEGCEVGGPTVYTRITAYLPWIRQQTAMTN 319
            :|...|.| ..|.|||.|..::|||.:..|..|
  Fly   529 WGIGCGRE-HLPGVYTNIQRFVPWINKVMANDN 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 87/255 (34%)
Tryp_SPc 77..314 CDD:238113 88/257 (34%)
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 87/255 (34%)
Tryp_SPc 316..555 CDD:238113 88/257 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457740
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.