DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and Np

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster


Alignment Length:248 Identity:73/248 - (29%)
Similarity:112/248 - (45%) Gaps:17/248 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATVFAD 140
            ||.||..|..|.:|:|:.|....:...|.|||.:|:...:.:|||||:.:...:.:......: |
  Fly   797 RIVGGANAAFGRWPWQISLRQWRTSTYLHKCGAALLNENWAITAAHCVDNVPPSDLLLRLGEY-D 860

  Fly   141 VEDSVEELQVTHRDFIIYPDYLGFGGYS---DLALIRLPRKVRTSEQVQPIELAGEFMHQNFLVG 202
            :.:..|......|...|...:..|...:   ||||:|....|.....:.|:.:...  .:|| :|
  Fly   861 LAEEEEPYGYQERRVQIVASHPQFDPRTFEYDLALLRFYEPVIFQPNIIPVCVPDN--DENF-IG 922

  Fly   203 KVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERC-ICYFLPGLVSQRRH--LCTD-GSNGRGAC 263
            :...::|||.|.:. .....:||.:...||:...| ..|...|.:....|  :|.. ...|..:|
  Fly   923 QTAFVTGWGRLYED-GPLPSVLQEVAVPVINNTICESMYRSAGYIEHIPHIFICAGWKKGGYDSC 986

  Fly   264 NGDSGGPVVYHWRNVS--YLIGVTSFGSAEGC-EVGGPTVYTRITAYLPWIRQ 313
            .||||||:|....:..  :|.||.|:|.  || |...|.|||||:.:..||.|
  Fly   987 EGDSGGPMVLQRESDKRFHLGGVISWGI--GCAEANQPGVYTRISEFRDWINQ 1037

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 70/244 (29%)
Tryp_SPc 77..314 CDD:238113 72/247 (29%)
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 70/244 (29%)
Tryp_SPc 798..1038 CDD:238113 72/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.