DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CG8738

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster


Alignment Length:266 Identity:66/266 - (24%)
Similarity:106/266 - (39%) Gaps:70/266 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 FPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATVFADVEDS-------- 144
            ||:.|.| :.:.|..:  |||:||..|.|||:||              .||...|||        
  Fly   213 FPWMVAL-MDMEGNFV--CGGTLIHPQLVLTSAH--------------NVFNRSEDSLLVRAGDW 260

  Fly   145 ---------------VEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPI------ 188
                           :.||   ||    :.::.....|:|:||:.|.|..:.:..:|||      
  Fly   261 DLNSQTELHPYQMRAISEL---HR----HENFNNLTLYNDIALVVLERPFQVAPHIQPICLPPPE 318

  Fly   189 --ELAGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRH 251
              ::..|....:.|.      :|||....::.....||:.::...:|.|.|.......::.:|.:
  Fly   319 TPQMEAELRSASCLA------TGWGLRYSTSRTMENLLKRIELPAVDHESCQRLLRHTVLGRRYN 377

  Fly   252 L-----CTDGSNGRGACNGDSGGPV---VYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYL 308
            |     |..|..|:..|.||.|.|:   :...::...|:|:.|:| .|..|...|..||.:....
  Fly   378 LHPSFTCAGGVKGKDTCMGDGGSPLFCTLPGQKDRYQLVGLVSWG-IECAEKDVPAAYTNVAYLR 441

  Fly   309 PWIRQQ 314
            .||.:|
  Fly   442 NWIDEQ 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 63/261 (24%)
Tryp_SPc 77..314 CDD:238113 65/264 (25%)
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 65/264 (25%)
Tryp_SPc 207..444 CDD:214473 63/261 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457456
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.