DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CG8738

DIOPT Version :10

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster


Alignment Length:266 Identity:66/266 - (24%)
Similarity:106/266 - (39%) Gaps:70/266 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 FPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATVFADVEDS-------- 144
            ||:.|.| :.:.|..:  |||:||..|.|||:||              .||...|||        
  Fly   213 FPWMVAL-MDMEGNFV--CGGTLIHPQLVLTSAH--------------NVFNRSEDSLLVRAGDW 260

  Fly   145 ---------------VEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPI------ 188
                           :.||   ||    :.::.....|:|:||:.|.|..:.:..:|||      
  Fly   261 DLNSQTELHPYQMRAISEL---HR----HENFNNLTLYNDIALVVLERPFQVAPHIQPICLPPPE 318

  Fly   189 --ELAGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRH 251
              ::..|....:.|.      :|||....::.....||:.::...:|.|.|.......::.:|.:
  Fly   319 TPQMEAELRSASCLA------TGWGLRYSTSRTMENLLKRIELPAVDHESCQRLLRHTVLGRRYN 377

  Fly   252 L-----CTDGSNGRGACNGDSGGPV---VYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYL 308
            |     |..|..|:..|.||.|.|:   :...::...|:|:.|:| .|..|...|..||.:....
  Fly   378 LHPSFTCAGGVKGKDTCMGDGGSPLFCTLPGQKDRYQLVGLVSWG-IECAEKDVPAAYTNVAYLR 441

  Fly   309 PWIRQQ 314
            .||.:|
  Fly   442 NWIDEQ 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 77..314 CDD:238113 65/264 (25%)
CG8738NP_610403.1 CLIP_1 112..163 CDD:465709
Tryp_SPc 207..447 CDD:238113 65/264 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.