DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CG8586

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster


Alignment Length:319 Identity:73/319 - (22%)
Similarity:123/319 - (38%) Gaps:93/319 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FEHPKEETPDDDDAIMERRWQLGYENFRLRCEKFEMEGNQTAAVRTRIAGGELATRGMFPYQVGL 94
            :.:||...||:|                    ||..             ..:::..|.||:.||:
  Fly   174 YSNPKGLIPDND--------------------KFPY-------------SEDVSIFGEFPWMVGI 205

  Fly    95 VIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATVFADVED---------------S 144
               .:|.....|||:||..:.|:|.:|.|.:.      |..|:.|...|               .
  Fly   206 ---FTGRQEFLCGGTLIHPRLVVTTSHNLVNE------TVDTLVARAGDWDLNSLNEPYPHQGSR 261

  Fly   145 VEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIEL----AGEFMHQNFLVGKVV 205
            ::|: :.|.:|  .|:.|    |:|:||:.|...:|.:..:||:.|    :.|..:|  |:....
  Fly   262 IKEI-IMHSEF--DPNSL----YNDIALLLLDEPIRLAPHIQPLCLPPPESPELTNQ--LLSVTC 317

  Fly   206 TLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHL-----CTDGSNGRGACNG 265
            ..:|||.....:||...:|:.::..::::|.|........:..|..|     |..|..|:..|.|
  Fly   318 YATGWGTKEAGSDKLEHVLKRINLPLVEREECQAKLRNTRLEARFRLRPSFICAGGDPGKDTCKG 382

  Fly   266 DSGGPVV---------YHWRNVSYLIGVTSFGSAEGCEVGG-PTVYTRITAYLPWIRQQ 314
            |.|.|:.         |.      |:|:.|:|..  |.|.. |.||..:.....||.::
  Fly   383 DGGSPLFCQMPGEMDRYQ------LVGIVSWGVE--CAVEDIPAVYVNVPHLRGWIDEK 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 64/268 (24%)
Tryp_SPc 77..314 CDD:238113 66/270 (24%)
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 66/261 (25%)
Tryp_SPc 197..430 CDD:214473 64/258 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457450
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.