DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and Jon44E

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:249 Identity:92/249 - (36%)
Similarity:122/249 - (48%) Gaps:20/249 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATV 137
            :..||..|..|..|..||.|||.....|   ..||||:|...:|||||||...|....||.||:.
  Fly    37 IEGRITNGYPAYEGKIPYIVGLSFNDGG---YWCGGSIIDHTWVLTAAHCTNSANHVLIYFGASF 98

  Fly   138 FADVEDSVEELQVTH----RDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQN 198
                   ..|.|.||    .|.|.:||:..|.. :|:||||:|. |.....|..:||.......|
  Fly    99 -------RHEAQYTHWVSRSDMIQHPDWNDFLN-NDIALIRIPH-VDFWSLVNKVELPSYNDRYN 154

  Fly   199 FLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGSNGRGAC 263
            ...|.....|||| |.|:....:..|..:|.::||...|..|:....::... :|.:...|:.:|
  Fly   155 SYSGWWAVASGWG-LTDNNSGMSNYLNCVDVQIIDNNDCRNYYGSNYITDNT-ICINTDGGKSSC 217

  Fly   264 NGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQQTAM 317
            :||||||:|.|..|  .::|:.||||.|||..|.|..:||:|.||.|||..|.:
  Fly   218 SGDSGGPLVLHDNN--RIVGIVSFGSGEGCTAGRPAGFTRVTGYLDWIRDHTGI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 88/238 (37%)
Tryp_SPc 77..314 CDD:238113 90/240 (38%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 88/238 (37%)
Tryp_SPc 41..266 CDD:238113 90/240 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
65.820

Return to query results.
Submit another query.