DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CG18478

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster


Alignment Length:288 Identity:81/288 - (28%)
Similarity:116/288 - (40%) Gaps:78/288 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GNQTAA-VRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAK 130
            ||..|. |:..:..|: |....||:.:.::...|   ||. ||||||...||||||        :
  Fly    34 GNPDAVKVQFNVTEGQ-AKPAEFPWTIAVIHNRS---LVG-GGSLITPDIVLTAAH--------R 85

  Fly   131 IYTGATVFADVEDSV-----------------EEL----QVTHRDFIIYPDYLGFGGYSDLALIR 174
            |:.     .||||.|                 ||.    .|.|:.|    :|.  .|.::|||:.
  Fly    86 IFN-----KDVEDIVVSAGEWEYGSALEKYPFEEAFVLKMVIHKSF----NYQ--RGANNLALLF 139

  Fly   175 LPRKVRTSEQVQPIELAGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCIC 239
            |.|:...:.::..|.|..:   :..|......::|||....|......:|:.:|..::  .|.||
  Fly   140 LDREFPLTYKINTICLPTQ---KRSLSSTRCIVAGWGKYQFSDTHYGGVLKKIDLPIV--PRHIC 199

  Fly   240 ------------YFLP-GLVSQRRHLCTDGSNGRGACNGDSGG----PVVYHWRNVSYLIGVTSF 287
                        |.|| ||:      |..|.....||.||.||    |:....:.... ||:.::
  Fly   200 QDQLRKTRLGQNYTLPRGLI------CAGGEKDNDACTGDGGGALFCPMTEDPKQFEQ-IGIVNW 257

  Fly   288 GSAEGC-EVGGPTVYTRITAYLPWIRQQ 314
            |  .|| |...|..||.:..:.|||.||
  Fly   258 G--VGCKEKNVPATYTDVFEFKPWIVQQ 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 73/273 (27%)
Tryp_SPc 77..314 CDD:238113 75/275 (27%)
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 74/269 (28%)
Tryp_SPc 50..280 CDD:214473 72/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457590
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.