DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and PRSS48

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:293 Identity:82/293 - (27%)
Similarity:131/293 - (44%) Gaps:32/293 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 RWQLGYEN-----------FRLRCEKFEMEGNQTAAVRTRIAGGELATRGMFPYQVGLVIQLSGA 101
            ||:.|.::           |.:......:...| ....:|:.||:.|..|.:|:||.|....:  
Human    12 RWEFGNDDKVGTRETGLLGFHISLSSLSLVCGQ-PVYSSRVVGGQDAAAGRWPWQVSLHFDHN-- 73

  Fly   102 DLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATVFADVEDSVEELQVTHRDFIIYPDYLGFGG 166
              ..|||||::.:.:||||||:........||.......|.||.:.::......:|:|.|.  ..
Human    74 --FICGGSLVSERLILTAAHCIQPTWTTFSYTVWLGSITVGDSRKRVKYYVSKIVIHPKYQ--DT 134

  Fly   167 YSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTR-LLQYLDAE 230
            .:|:||::|..:|..:..:.||.|..  :.:...:.....::|||.:.:|:|:... .||..:..
Human   135 TADVALLKLSSQVTFTSAILPICLPS--VTKQLAIPPFCWVTGWGKVKESSDRDYHSALQEAEVP 197

  Fly   231 VIDQERC------ICYFLPGL--VSQRRHLCT-DGSNGRGACNGDSGGPVVYHWRNVSYLIGVTS 286
            :||::.|      |..|||.|  |.:...:|. |..|.:.:|.||||||:..|...|....||.|
Human   198 IIDRQACEQLYNPIGIFLPALEPVIKEDKICAGDTQNMKDSCKGDSGGPLSCHIDGVWIQTGVVS 262

  Fly   287 FGSAEGCEVGGPTVYTRITAYLPWIRQQTAMTN 319
            :|..  |....|.|||.:..|..||....:..|
Human   263 WGLE--CGKSLPGVYTNVIYYQKWINATISRAN 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 74/244 (30%)
Tryp_SPc 77..314 CDD:238113 75/246 (30%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 74/244 (30%)
Tryp_SPc 51..288 CDD:238113 75/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.