DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6462 and CG5390

DIOPT Version :9

Sequence 1:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster


Alignment Length:290 Identity:76/290 - (26%)
Similarity:118/290 - (40%) Gaps:65/290 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GYEN-----FRLRCEKFEMEGNQTAAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLI 111
            ||:|     |::           |.||......||      ||:.:.::.:....:|.:|||:||
  Fly   136 GYQNPNGVGFKI-----------TGAVNQEAEFGE------FPWMLAILREEGNLNLYECGGALI 183

  Fly   112 TLQFVLTAAHCLTDAIAAKIYTGATVFADVEDSVEELQV-THRD----FIIYPDYLGFGG-YSDL 170
            ....|||||||:.:...:.|    .|.|...|:..:.:: .|.|    .|||.:....|. |:|:
  Fly   184 APNVVLTAAHCVHNKQPSSI----VVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDV 244

  Fly   171 ALIRLPRKVRTSEQVQPIELAGEFMHQNFLVGKVVTL-----SGWGYLGDSTDKRTR-LLQYLDA 229
            |::.|.......|.:|.:.|..        ||.....     :|||......|...: :|:.:|.
  Fly   245 AVMLLESPFTLQENIQTVCLPN--------VGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDM 301

  Fly   230 EVIDQERCICYFLPGLVSQR--RH-------LCTDGSNGRGACNGDSGGPVV---YHWRNVSYLI 282
            .|:.:::|    ...|...|  ||       :|..|...:..|.||.|.|:|   ...:|.....
  Fly   302 PVVPEQQC----ETNLRETRLGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSA 362

  Fly   283 GVTSFGSAEGC-EVGGPTVYTRITAYLPWI 311
            |:.::|.  || ||..|.||..:....|||
  Fly   363 GIVAWGI--GCGEVNIPGVYASVAKLRPWI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 67/259 (26%)
Tryp_SPc 77..314 CDD:238113 69/260 (27%)
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 69/262 (26%)
Tryp_SPc 153..390 CDD:214473 67/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457444
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.